PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G24320.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 504aa    MW: 53914.3 Da    PI: 8.4954
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G24320.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.31.4e-40210286278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      CqvegC++dls+ +eyhr+hkvCe+hskap+v+vsgle+rfCqqCsrfh l efD++k+sCrrrL++hn+rrrk+q+
  OPUNC06G24320.3 210 CQVEGCKVDLSSSREYHRKHKVCEAHSKAPKVIVSGLERRFCQQCSRFHGLAEFDQKKKSCRRRLSDHNARRRKPQQ 286
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-32202271IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.3207284IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-38209289IPR004333Transcription factor, SBP-box
PfamPF031102.7E-31210283IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MAIVFIQVEY NGDNDSLSAK GAAVEILNSV MASFGMNWNQ KSPVFWDWEN PAPFGPNTME  60
NPKSIPHPEP RGVVVGAANH GSTNSSGGTF TSSSELANGS SKSSLSASFD SSSKLGNSLE  120
FRFASVKGHG KNMCKDGEAG RVEDSGTSPA VAVSHGEPVI GLKLGKRTYF ENVCGGQNVK  180
SSSAASAVTC PSTVVKKMKV SQQSTQSSYC QVEGCKVDLS SSREYHRKHK VCEAHSKAPK  240
VIVSGLERRF CQQCSRFHGL AEFDQKKKSC RRRLSDHNAR RRKPQQEAIS FGSSRLASMF  300
YDARQQTDIY FGQSPFGQVR SNAISSCDNL GGFKFTEAKL PWMKPMKTIG LEDLHFSTVQ  360
MPNNVVAHTV HHHDFDGLIP FKGNTTKVLN QGVDPACAVV SSNSNGAPDL RRALSLLSSD  420
SWGPADVQAG SQVHPGGVMP LLAVAATVTA PTNSVSVMHA LHPSPGGGGF WQDDDDPAPL  480
DHGVQAQAFM HLGNGSNSGF GNLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-272102831184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265282KKKSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0731790.0AK073179.1 Oryza sativa Japonica Group cDNA clone:J033004F21, full insert sequence.
GenBankAK1021360.0AK102136.1 Oryza sativa Japonica Group cDNA clone:J033085H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643462.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643461.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643459.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643458.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643457.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643456.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643455.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643454.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643453.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643452.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643451.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643450.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643449.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643448.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotA2YGR50.0SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A0E0LFC80.0A0A0E0LFC8_ORYPU; Uncharacterized protein
STRINGBGIOSGA020577-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-50squamosa promoter binding protein-like 10